You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324515 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RCOR3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | RCOR3 |
UniProt ID | Q9P2K3 |
Protein Sequence | Synthetic peptide located within the following region: MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIA |
NCBI | NP_060724 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti RP11-318L16.1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Spleen
WB Suggested Anti-RCOR3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, RCOR3 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating