You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587929 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RCAN1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RCAN1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 27kDa |
Target | RCAN1 |
UniProt ID | P53805 |
Protein Sequence | Synthetic peptide located within the following region: LHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: RCAN1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: RCAN1, Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-RCAN1 Antibody, Catalog Number: orb587929, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating