RCAN1 antibody

• Catalog Number: orb587929
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RCAN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RCAN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: RCAN1
• UniProt ID: P53805
• Protein Sequence: Synthetic peptide located within the following region: LHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: RCAN1, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: RCAN1, Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-RCAN1 Antibody, Catalog Number: orb587929, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.