You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576690 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RCAN1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RCAN1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | RCAN1 |
UniProt ID | P53805 |
Protein Sequence | Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME |
NCBI | NP_004405 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSP1, DSC1, RCN1, DSCR1, MCIP1, ADAPT78 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RCAN1, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: RCAN1, Sample Type: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
RCAN1 antibody - middle region (orb576690) validated by WB using Mouse Brain at 1:500.
RCAN1 antibody - middle region (orb576690) validated by WB using MOUSE OSTEOCLASTS at 1:1000.
WB Suggested Anti-RCAN1 Antibody, Positive Control: Lane 1: 20 ug Wild type mouse, left ventricle, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.
WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
IH, WB | |
Human, Mouse, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating