You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577515 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBPMS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ICC, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBPMS |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | RBPMS |
UniProt ID | Q93062 |
Protein Sequence | Synthetic peptide located within the following region: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ |
NCBI | NP_001008712 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HERMES Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Mouse Retina Fixation of the tissues with 4% paraformaldehyde in 0.1M PO4, and performed typical procedures of immunocytochemistry. Blocking solution was 0.2% triton X-100 + 5% normal donkey serum in PBS. RBPMS antibody was incubated in blocking solution with 1:200 dilution (4 degree, overnight). Secondary antibody was Cy3-conjugated.
Rabbit Anti-RBPMS Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-RBPMS Antibody Titration: 0.5 ug/ml, Positive Control: Human Liver.
WB Suggested Anti-RBPMS Antibody, Titration: 0.5 ug/ml, Positive Control: Liver.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating