You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577838 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBM47 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RBM47 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64 kDa |
Target | RBM47 |
UniProt ID | A0AV96 |
Protein Sequence | Synthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA |
NCBI | NP_061900 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NET18 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RBM47, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RBM47, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. The protein may be modified by methylation.
Host: Rabbit, Target Name: RBM47, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RBM47, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RBM47, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: RBM47, Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 1 ug/ml.
Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. PrimaryAntibody concentration 5 ug/ml.
WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: NCI-H226.
Filter by Rating