You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573578 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBM10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 104 kDa |
Target | RBM10 |
UniProt ID | P98175 |
Protein Sequence | Synthetic peptide located within the following region: QRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEEKAS |
NCBI | NP_005667 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is also present at 94 kDa. The protein is modified by phosphorylation.
Host: Mouse, Target Name: RBM10, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: RBM10, Positive control (+): Mouse kidney (M-KI), Negative control (-): Rat liver (R-LI), Antibody concentration: 1 ug/ml.
Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Epithelial cells of bronchiole, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
RBM10 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573578 with 1:200 dilution. Western blot was performed using orb573578 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: RBM10 IP with orb573578 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
WB Suggested Anti-RBM10 Antibody Titration: 1.4 ug/ml, ELISA Titer: 1:1562500, Positive Control: Daudi cell lysate, RBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating