You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573577 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBM10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RBM10 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 104kDa |
Target | RBM10 |
UniProt ID | P98175 |
Protein Sequence | Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH |
NCBI | NP_005667 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | S1-1, TARPS, GPATC9, ZRANB5, GPATCH9, DXS8237E Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of collecting tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-RBM10 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-RBM10 Antibody Titration: 1.4 ug/ml, ELISA Titer: 1:62500, Positive Control: Daudi cell lysate, RBM10 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.
IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating