You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581252 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RBBP8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RBBP8 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 98kDa |
Target | RBBP8 |
UniProt ID | A6NKN2 |
Protein Sequence | Synthetic peptide located within the following region: ETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEE |
NCBI | NP_976037 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RIM, COM1, CTIP, JWDS, SAE2, SCKL2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. HCT116 lysate (50 ug), 2. MCF7 lysate (50 ug), 3. rCtIP (30 ng), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit IR700, Secondary dilution: 1:5000.
Host: Rabbit, Target Name: RBBP8, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-RBBP8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating