You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334529 |
---|---|
Category | Antibodies |
Description | RbAp48/RBBP4 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC-Fr, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 47656 MW |
UniProt ID | Q09028 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Histone-binding protein RBBP4;Chromatin assembly f Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of 293T cells using anti-RbAp48 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of RbAp48 using anti-RbAp48 antibody.Lane 1:Rat Brain Tissue;2:Mouse Liver Tissue;3:Mouse Lung Tissue;4:HELA Cell;5:JURKAT Cell.
IF analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in immunocytochemical section of A431 cells.
IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Mouse Liver Tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Rat Intestine Tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of mouse small intestine tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of human placenta tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of rat small intestine tissue.
IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of mouse liver tissue.
IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating