You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb10081 |
---|---|
Category | Proteins |
Description | Recombinant of rat Sult1a1 protein |
Tag | N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 53.9 kDa |
UniProt ID | P17988 |
Protein Sequence | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
Protein Length | Full Length |
Source | E.coli |
Biological Origin | Rattus norvegicus (Rat) |
Expression Region | 1-291aa |
Endotoxins | Not test. |
RRID | AB_10752190 |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Aryl sulfotransferase Aryl sulfotransferase IV Read more... |
Note | For research use only |
Application notes | Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-291aaSequence Info: Full LengthGlycerol content: 0.5 |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
31.9 kDa | |
E.Coli |
Filter by Rating