Cart summary

You have no items in your shopping cart.

    Rat Q5PPP2 protein (Active)

    Catalog Number: orb359140

    DispatchUsually dispatched within 1-2 weeks
    $ 3,048.00
    Catalog Numberorb359140
    CategoryProteins
    DescriptionRecombinant rat Q5PPP2 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 96% as determined by SDS-PAGE and HPLC.
    MW10.5 kDa
    UniProt IDQ5PPP2
    Protein SequenceM+PTGSVTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
    Protein LengthPartial
    SourceE.Coli
    Biological OriginRattus norvegicus (Rat)
    Biological ActivityFully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration of 50-250 ng/ml.
    Expression Region23-119aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Rat Q5PPP2 protein (Active)

    SDS-PAGE analysis of Rat Q5PPP2 protein (Active)

    Rat Q5PPP2 protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars