You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603948 |
---|---|
Category | Proteins |
Description | Recombinant Rat Complement C5(C5) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 14.0 kDa |
UniProt ID | P08650 |
Protein Sequence | DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR |
Protein Length | Full Length |
Source | E.coli |
Biological Origin | Rattus norvegicus (Rat) |
Expression Region | 1-77aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | C5Complement C5 [Cleaved into, C5a anaphylatoxin], Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
74.1 kDa (β chain) & 114.8 kDa (α chain) | |
Rat Complement C5, His Tag (orb570266) is expressed from human 293 cells (HEK293). It contains AA Gln 24 - Ala 1688 (Accession # XP_001079130.2). |
Filter by Rating