You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216247 |
---|---|
Category | Proteins |
Description | The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.4 kDa |
Target | APRIL |
Entrez | 287437 |
Protein Sequence | AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) |
Protein Length | 146 |
Source | Yeast |
Storage | -20°C |
Alternative names | TNFSF13 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating