You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583195 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RASGRF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 145kDa |
Target | RASGRF1 |
UniProt ID | Q13972 |
Protein Sequence | Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG |
NCBI | NP_002882 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RASGRF1, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RASGRF1, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-RASGRF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating