RARB Rabbit Polyclonal Antibody

• Catalog Number: orb579504
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RARB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RARB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: RARB
• UniProt ID: P10826
• Protein Sequence: Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS
• NCBI: NP_000956
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HAP, RRB2, NR1B2, MCOPS12, RARbeta1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Brain, cortex.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.