RAPGEF2 antibody

• Catalog Number: orb578594
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAPGEF2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse RAPGEF2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 164kDa
• Target: RAPGEF2
• UniProt ID: Q8CHG7
• Protein Sequence: Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
• NCBI: XP_006502317.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: nR, CNRa, Pdzgef, RA-GEF, Pdzgef1, nRapGEP, CNRasG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: Rapgef2, Sample Type: Mouse Brain lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-RAPGEF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-RAPGEF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.