You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583193 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAP1GAP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | RAP1GAP |
UniProt ID | P47736 |
Protein Sequence | Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA |
NCBI | NP_002876 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RAPGAP, RAP1GA1, RAP1GAP1, RAP1GAPII Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.
WB Suggested Anti-RAP1GAP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. RAP1GAP is supported by BioGPS gene expression data to be expressed in HEK293T.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |