RALY antibody

• Catalog Number: orb574923
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RALY
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RALY
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: RALY
• UniProt ID: Q9UKM9
• Protein Sequence: Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
• NCBI: NP_031393
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P542, HNRPCL2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: RALY, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

Human Brain

WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, RALY is supported by BioGPS gene expression data to be expressed in Jurkat.