You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
RALY Rabbit Polyclonal Antibody
Catalog Number: orb574923
| Catalog Number | orb574923 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RALY |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RALY |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 32kDa |
| Target | RALY |
| UniProt ID | Q9UKM9 |
| Protein Sequence | Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
| NCBI | NP_031393 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | P542, HNRPCL2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.
Human Brain
WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, RALY is supported by BioGPS gene expression data to be expressed in Jurkat.
- Item 1 of 3
- Item 1 of 1
- Item 1 of 1
- Item 1 of 2
RALY Rabbit Polyclonal Antibody [orb574515]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
