You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574923 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RALY |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RALY |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | RALY |
UniProt ID | Q9UKM9 |
Protein Sequence | Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
NCBI | NP_031393 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P542, HNRPCL2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RALY, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.
Human Brain
WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, RALY is supported by BioGPS gene expression data to be expressed in Jurkat.
Filter by Rating