You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1474866 |
---|---|
Category | Antibodies |
Description | RAGE/AGER Antibody (monoclonal, 5C6C1) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5C6C1 |
Tested applications | FC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 43 kDa |
UniProt ID | Q15109 |
Storage | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Expiration Date | 12 months from date of receipt. |
IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of mouse lung tissue.
IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.
IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.
Western blot analysis of RAGE/AGER using anti-RAGE/AGER antibody.
Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.
FC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating