Cart summary

You have no items in your shopping cart.

    RAGE/AGER Antibody (monoclonal, 5C6C1)

    Catalog Number: orb1474866

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb1474866
    CategoryAntibodies
    DescriptionRAGE/AGER Antibody (monoclonal, 5C6C1)
    Species/HostMouse
    ClonalityMonoclonal
    Clone Number5C6C1
    Tested applicationsFC, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeIgG2b
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW43 kDa
    UniProt IDQ15109
    StorageAt -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Expiration Date12 months from date of receipt.
    RAGE/AGER Antibody (monoclonal, 5C6C1)

    IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of mouse lung tissue.

    RAGE/AGER Antibody (monoclonal, 5C6C1)

    IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.

    RAGE/AGER Antibody (monoclonal, 5C6C1)

    IHC analysis of RAGE/AGER using anti-RAGE/AGER antibody. RAGE/AGER was detected in a paraffin-embedded section of rat lung tissue.

    RAGE/AGER Antibody (monoclonal, 5C6C1)

    Western blot analysis of RAGE/AGER using anti-RAGE/AGER antibody.

    RAGE/AGER Antibody (monoclonal, 5C6C1)

    Flow Cytometry analysis of Jurkat cells using anti-RAGE/AGER antibody(Blue line).Isotype control antibody(Green line) was mouse IgG.Unlabelled sample(Red line) was also used as a control.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars