You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578659 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rag1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Mouse, Porcine, Rat |
Reactivity | Animal, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 119 kDa |
Target | Rag1 |
UniProt ID | P15919 |
Protein Sequence | Synthetic peptide located within the following region: IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT |
NCBI | NP_033045 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Rag, Rag-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-Rag1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.
FC, WB | |
Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating