RAD9B antibody

• Catalog Number: orb581898
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAD9B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD9B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: RAD9B
• UniProt ID: Q6WBX8
• Protein Sequence: Synthetic peptide located within the following region: ATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCL
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: RAD9B, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: RAD9B, Sample Type: Fetal Thymus lysates, Antibody dilution: 1.0 ug/ml.