You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb443214 |
---|---|
Category | Antibodies |
Description | Rad51 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39 kDa |
UniProt ID | Q06609 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | DNA repair protein RAD51 homolog 1; HsRAD51; hRAD5 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of SiHa cells using anti-Rad51 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Rad51 using anti-Rad51 antibody.Lane 1:rat testis tissue;2:mouse testis tissue;3:mouse thymus tissue.
WB analysis of Rad51 using anti-Rad51 antibody.Lane 1:human HeLa Cell;2:human A431 Cell;3:human 293T Cell;4:human K562 Cell;5:human Jurkat Cell;6:human A549 Cell;7:human Caco-2 Cell.
IF analysis of Rad51 using anti-Rad51 antibody. Rad51 was detected in immunocytochemical section of U20S cells.
IHC analysis of Rad51 using anti-Rad51 antibody.Rad51 was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of Rad51 using anti-Rad51 antibody.Rad51 was detected in paraffin-embedded section of mouse brain tissue.
IHC analysis of Rad51 using anti-Rad51 antibody.Rad51 was detected in paraffin-embedded section of human testis tissue.
IHC analysis of Rad51 using anti-Rad51 antibody.Rad51 was detected in paraffin-embedded section of rat brain tissues.
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating