You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577700 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RACK1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | RACK1 |
UniProt ID | P63244 |
Protein Sequence | Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW |
NCBI | NP_006089 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: MCF-7 WT a whole cell lysates (110 UG), Primary Dilution: 1.5 mg/mL, Secondary Antibody: LI-COR Donkey anti-rabbit, Secondary Dilution: 1:10000. GNB2L1 is supported by BioGPS gene expression data to be expressed in MCF7.
Rabbit Anti-GNB2L1 Antibody, Catalog Number: orb577700, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GNB2L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. GNB2L1 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-GNB2L1 antibody Titration: 1 ug/ml, Sample Type: Human liver.
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine | |
Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating