Rabbit TNF protein

• Catalog Number: orb594859
• Category: Proteins
• Description: Recombinant Rabbit Tumor necrosis factor(TNF),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 17.59 kDa
• UniProt ID: P04924
• Protein Sequence: VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
• Protein Length: Partial
• Source: E.coli
• Biological Origin: Oryctolagus cuniculus (Rabbit)
• Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 3.5 pg/ml.
• Expression Region: 78-235aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 300 mM NaCl, pH 7.4
• Alternative names: Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor
• Background: Tumor necrosis factor alpha (TNFα) is the prototypic ligand of the TNF superfamily. TNFα forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNFα is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFα is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target ce
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.