You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820841 |
---|---|
Category | Proteins |
Description | The Rabbit IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEH LKAYLKANTS DVANGGPLFL NILRNWKEES DNKIIQSQIV SFYFKLFDNL KDHEVIKKSM ESIKEDIFVK FFNSNLTKMD DFQNLTRISV DDRLVQRKAV SELSNVLNFL SPKSNLKKRK RSQTLFRGRR ASKY (144)) (Gene ID: 100008602). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.9 kDa |
Target | IFN gamma |
Entrez | 100008602 |
Protein Sequence | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144) |
Protein Length | 144 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating