You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215705 |
---|---|
Category | Proteins |
Description | The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.9 kDa |
Target | IFN gamma |
Entrez | 100008602 |
Protein Sequence | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144) |
Protein Length | 144 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating