You have no items in your shopping cart.
Cart summary
Rabbit CTLA-4 protein
Catalog Number: orb1215701
| Catalog Number | orb1215701 |
|---|---|
| Category | Proteins |
| Description | The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 13.5 kDa |
| Target | CTLA-4 |
| Entrez | 100009412 |
| Protein Sequence | LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124) |
| Protein Length | 124 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
- Item 1 of 3
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
