RAB6A Antibody

• Catalog Number: orb412982
• Category: Antibodies
• Description: RAB6A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24 kDa
• UniProt ID: P20340
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Ras-related protein Rab-6A; Rab-6; RAB6A; RAB6
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of RAB6A using anti-RAB6A antibody.Lane 1:human MDA-MB-453 cell;2:human SK-OV-3 cell;3:Human A431 cell;4:rat testis tissue;5:mouse brain tissue;6:mouse HEPA1-6 cell.

IHC analysis of RAB6A using anti-RAB6A antibody.RAB6A was detected in paraffin-embedded section of human placenta tissues.

IHC analysis of RAB6A using anti-RAB6A antibody.RAB6A was detected in paraffin-embedded section of rat small intestine tissues.