You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583215 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAB1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23kDa |
Target | RAB1A |
UniProt ID | P62820 |
Protein Sequence | Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
NCBI | NP_004152 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RAB1, YPT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: RAB1A, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.
Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-Rabbit, Secondary dilution: 1:40000.
Host: Mouse, Target Name: RAB1A, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: RAB1A, Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RAB1A, Sample Type: 293T Whole cell lysates, Antibody dilution: 0.2 ug/ml.
Host: Rabbit, Target Name: RAB1A, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. RAB1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
Rabbit Anti-RAB1A Antibody, Catalog Number: orb583215, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic in excellent staining, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-RAB1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep | |
Goat | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating