You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574520 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RAB18 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAB18 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23 kDa |
Target | RAB18 |
UniProt ID | Q9NP72 |
Protein Sequence | Synthetic peptide located within the following region: LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG |
NCBI | NP_067075 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | WARBM3, RAB18LI1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: RAB18, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target: RAB18, Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): THP1 Cell Lysate (N30), Antibody concentration: 1 ug/ml.
WB Suggested Anti-RAB18 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
FC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating