Cart summary

You have no items in your shopping cart.

    Rab11b Antibody - C-terminal : Biotin

    Rab11b Antibody - C-terminal : Biotin

    Catalog Number: orb2084389

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2084389
    CategoryAntibodies
    DescriptionRab11b Antibody - C-terminal : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen for Anti-Rab11b antibody is: synthetic peptide directed towards the C-terminal of Rat RB11B
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW23 kDa
    UniProt IDO35509
    Protein SequenceSynthetic peptide located within the following region: KNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCC
    NCBINP_116006.1
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars