You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582555 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PYCR2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PYCR2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | PYCR2 |
UniProt ID | Q96C36 |
Protein Sequence | Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE |
NCBI | NP_037460 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HLD10, P5CR2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1. 10 ug human fibroblast lysate, 2. 10 ug PYCR1 KO human fibroblast lysate, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: PYCR2.
PYCR2 antibody - middle region (orb582555) validated by WB using 293T cells lysate at 1 ug/ml.
Sample Type: 1. WT human fibroblast 2. PYCR1 KO human fibroblast, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PYCR2: Green DAPI:Blue, Gene Name: PYCR2.
WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Monkey, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating