You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583693 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PYCR1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PYCR1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 33kDa |
Target | PYCR1 |
UniProt ID | A6NFM2 |
Protein Sequence | Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR |
NCBI | NP_722546 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P5C, P5CR, PRO3, PYCR, PIG45, PP222, ARCL2B, ARCL3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: PYCR1, Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
PYCR1 antibody - middle region (orb583693) validated by WB using 293T cells lysate at 1 ug/ml. PYCR1 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB Suggested Anti-PYCR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. PYCR1 is supported by BioGPS gene expression data to be expressed in HepG2.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating