PVRL4/NECTIN4 Antibody

• Catalog Number: orb381093
• Category: Antibodies
• Description: PVRL4/NECTIN4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55454 MW
• UniProt ID: Q96NY8
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Nectin-4;Ig superfamily receptor LNIR;Nectin cell
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Nectin-4/PVRL4 using anti-Nectin-4/PVRL4 antibody.Lane 1:MCF-7 cell; 2:MM453 cell.