You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574556 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PURA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PURA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | PURA |
UniProt ID | Q00577 |
Protein Sequence | Synthetic peptide located within the following region: VEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYM |
NCBI | NP_005850 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PUR1, MRD31, PURALPHA, PUR-ALPHA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-PURA antibody (orb574556).
WB Suggested Anti-PURA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, PURA is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
Filter by Rating