You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577765 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PUF60 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | PUF60 |
UniProt ID | Q9UHX1 |
Protein Sequence | Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
NCBI | NP_055096 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FIR, VRJS, RoBPI, SIAHBP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PUF60, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PUF60, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-PUF60 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PUF60 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. PUF60 is supported by BioGPS gene expression data to be expressed in HeLa.
WB Suggested Anti-PUF60 Antibody Titration: 0.5 ug/ml Positive Control: Human 293T cell lysate.
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating