You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574866 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PTHLH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PTHLH |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 20kDa |
Target | PTHLH |
UniProt ID | P12272 |
Protein Sequence | Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
NCBI | NP_002811 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HHM, PLP, BDE2, PTHR, PTHRP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IHC Information:Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Primary antibody dilution: 1:1000, Secondary antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:2000.
Rabbit Anti-PTHLH Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of collecting tubule and renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PTHLH Antibody Titration: 2.0 ug/ml, Positive Control: HepG2 cell lysate.
ELISA, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating