You have no items in your shopping cart.
Cart summary
Item 1 of 1
PTGFRN antibody
Catalog Number: orb331302
| Catalog Number | orb331302 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PTGFRN |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 98kDa |
| Target | PTGFRN |
| UniProt ID | Q9P2B2 |
| Protein Sequence | Synthetic peptide located within the following region: SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT |
| NCBI | NP_065173 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti CD315 antibody, anti CD9P-1 antibody, anti EW Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PTGFRN Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
- Item 1 of 6
- Item 1 of 3
CD315 antibody [orb767242]
ELISA, IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50ul, 100ul - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
