You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574212 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSMD14 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | PSMD14 |
UniProt ID | O00487 |
Protein Sequence | Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
NCBI | NP_005796 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PAD1, POH1, RPN11 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: 1. 100 ug HeLa cell lysate, 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit AP, Secondary Antibody dilution: 1:10000, Gene Name: PSMD14.
Rabbit Anti-PSMD14 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating