You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584311 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSMC6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44kDa |
Target | PSMC6 |
UniProt ID | P62333 |
Protein Sequence | Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY |
NCBI | NP_002797 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p42, RPT5, SUG2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PSMC6, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: PSMC6, Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. PSMC6 is supported by BioGPS gene expression data to be expressed in MCF7.
Lanes: 1: 10 ug proteasome fraction from C57B1/6J mouse brain, 2: 10 ug proteasome fraction from BLAB/C mouse brain, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: PSMC6.
WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
ICC, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating