PSMC5 antibody

• Catalog Number: orb576569
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMC5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: PSMC5
• UniProt ID: P62195
• Protein Sequence: Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
• NCBI: NP_002796
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S8, p45, RPT6, SUG1, SUG-1, TBP10, TRIP1, p45/SUG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 4. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: PSMC5, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: PSMC5.

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: PSMC5: Red DAPI:Blue, Gene Name: PSMC5.

WB Suggested Anti-PSMC5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.