PSMA2 antibody

• Catalog Number: orb583168
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSMA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: PSMA2
• UniProt ID: P25787
• Protein Sequence: Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV
• NCBI: NP_002778
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MU, HC3, PSC2, PMSA2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PSMA2, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.

Host: Rabbit, Target Name: PSMA2, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Host: Rabbit, Target Name: PSMA2, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: PSMA2, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.

Host: Rabbit, Target Name: PSMA2, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.

WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.