You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583168 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSMA2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSMA2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 26kDa |
Target | PSMA2 |
UniProt ID | P25787 |
Protein Sequence | Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
NCBI | NP_002778 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | MU, HC3, PSC2, PMSA2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PSMA2, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.
Host: Rabbit, Target Name: PSMA2, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: PSMA2, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PSMA2, Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.
Host: Rabbit, Target Name: PSMA2, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.
WB Suggested Anti-PSMA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating