You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577574 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSMA1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PSMA1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | PSMA1 |
UniProt ID | P25786 |
Protein Sequence | Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
NCBI | NP_002777 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NU, HC2, PROS30, HEL-S-275 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-PSMA1 Antibody, Catalog Number: orb577574, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Human non-small cell lung cancer (NCI-460), Primary Dilution: 1:2000, Secondary Dilution: 1:3000, 50kDa band is a tubulin loading control band. PSMA1 is strongly supported by BioGPS gene expression data to be expressed in Human NCI460 cells.
WB Suggested Anti-PSMA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
Filter by Rating