You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575182 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PSIP1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSIP1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | PSIP1 |
UniProt ID | O75475 |
Protein Sequence | Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK |
NCBI | NP_150091 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | p52, p75, PAIP, DFS70, LEDGF, PSIP2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Jurkat
Rabbit Anti-PSIP1 antibody, Catalog Number: orb575182, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-PSIP1 Antibody, Titration: 5 ug/ml, Positive Control: Jurkat Whole Cell, PSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating