PSG1 antibody

• Catalog Number: orb330232
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PSG1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSG1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PSG1
• UniProt ID: Q6ICR4
• Protein Sequence: Synthetic peptide located within the following region: SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
• NCBI: NP_008836
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti B1G1 antibody, anti CD66f antibody, anti DHFR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-PSG1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PSG1 Antibody Titration: 1 ug/mL, Positive Control: Human placenta and mouse placenta.

WB Suggested Anti-PSG1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.