Cart summary

You have no items in your shopping cart.

    Proteasome 20S alpha 3/PSMA3 Antibody

    Catalog Number: orb381091

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb381091
    CategoryAntibodies
    DescriptionProteasome 20S alpha 3/PSMA3 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IHC, IHC-Fr, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW28433 MW
    UniProt IDP25788
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesProteasome subunit alpha type-3;3.4.25.1;Macropain
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Proteasome 20S alpha 3/PSMA3 Antibody

    Flow Cytometry analysis of HeLa cells using anti-PSMA3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    Proteasome 20S alpha 3/PSMA3 Antibody

    WB analysis of PSMA3 using anti-PSMA3 antibody.Lane 1:rat testis tissue;2:mouse lung tissue;3:293T cell.

    Proteasome 20S alpha 3/PSMA3 Antibody

    IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of human intestinal cancer tissues.

    Proteasome 20S alpha 3/PSMA3 Antibody

    IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of mouse brain tissues.

    Proteasome 20S alpha 3/PSMA3 Antibody

    IHC analysis of PSMA3 using anti-PSMA3 antibody.PSMA3 was detected in paraffin-embedded section of rat brain tissues.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars