You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334514 |
---|---|
Category | Antibodies |
Description | Prolactin Receptor/PRLR Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino aci |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 69506 MW |
UniProt ID | P16471 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Prolactin receptor;PRL-R;PRLR; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of PRLR using anti-PRLR antibody.Lane 1:HELA Cell;2:SGC Cell;3:SW620 Cell.
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating