Prnp antibody

• Catalog Number: orb331215
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Prnp
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Goat, Human, Rat, Sheep
• Reactivity: Canine, Goat, Human, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: Prnp
• UniProt ID: P04925
• Protein Sequence: Synthetic peptide located within the following region: GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
• NCBI: NP_035300
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AA960666 antibody, anti AI325101 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of mouse Kidney tissue using Prnp antibody

Host: Rabbit, Target Name: Prnp, Sample Type: Mouse Kidney lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-PRNP Antibody, Catalog Number: orb331215, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Plasma membrane and cytoplasm in Leydig cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.