PRMT5 antibody

• Catalog Number: orb330097
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRMT5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: PRMT5
• UniProt ID: O14744
• Protein Sequence: Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS
• NCBI: NP_001034708
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti JBP1 antibody, anti SKB1 antibody, anti IBP72
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Lung tissue using PRMT5 antibody

Western blot analysis of Jurkat cell lysate tissue using PRMT5 antibody

Immunohistochemical staining of human Kidney tissue using PRMT5 antibody

Rabbit Anti-PRMT5 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Rabbit Anti-PRMT5 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PRMT5 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, PRMT5 is supported by BioGPS gene expression data to be expressed in Jurkat.