PRMT2 antibody

• Catalog Number: orb577481
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRMT2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: PRMT2
• UniProt ID: P55345
• Protein Sequence: Synthetic peptide located within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
• NCBI: NP_001526
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HRMT1L1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

PRMT2 antibody - N-terminal region (orb577481) validated by WB using human LCL and mouse brains at 1:1000.

Rabbit Anti-PRMT2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-PRMT2 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Liver cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PRMT2 Antibody Titration: 0.625 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.